| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.58: TTP0101/SSO1404-like [143430] (2 families) ![]() contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily |
| Family d.58.58.0: automated matches [191564] (1 protein) not a true family |
| Protein automated matches [190980] (1 species) not a true protein |
| Species Sulfolobus solfataricus [TaxId:2287] [188660] (1 PDB entry) |
| Domain d3excx_: 3exc X: [175288] automated match to d2i8ea1 complexed with cl, na |
PDB Entry: 3exc (more details), 2.25 Å
SCOPe Domain Sequences for d3excx_:
Sequence, based on SEQRES records: (download)
>d3excx_ d.58.58.0 (X:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mkllvvydvsddskrnklannlkklgleriqrsafegdmdsqrmkdlvrvvklivdtntd
ivhiiplgirdwerrivigr
>d3excx_ d.58.58.0 (X:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mkllvvydvsddskrnklannlkklgleriqrsafegdmdrmkdlvrvvklivdtntdiv
hiiplgirdwerrivigr
Timeline for d3excx_: