Lineage for d3excx_ (3exc X:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2956212Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) (S)
    contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily
  5. 2956238Family d.58.58.0: automated matches [191564] (1 protein)
    not a true family
  6. 2956239Protein automated matches [190980] (6 species)
    not a true protein
  7. 2956257Species Sulfolobus solfataricus [TaxId:2287] [188660] (1 PDB entry)
  8. 2956258Domain d3excx_: 3exc X: [175288]
    automated match to d2i8ea1
    complexed with cl, na

Details for d3excx_

PDB Entry: 3exc (more details), 2.25 Å

PDB Description: structure of the rna'se sso8090 from sulfolobus solfataricus
PDB Compounds: (X:) Uncharacterized protein

SCOPe Domain Sequences for d3excx_:

Sequence, based on SEQRES records: (download)

>d3excx_ d.58.58.0 (X:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mkllvvydvsddskrnklannlkklgleriqrsafegdmdsqrmkdlvrvvklivdtntd
ivhiiplgirdwerrivigr

Sequence, based on observed residues (ATOM records): (download)

>d3excx_ d.58.58.0 (X:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mkllvvydvsddskrnklannlkklgleriqrsafegdmdrmkdlvrvvklivdtntdiv
hiiplgirdwerrivigr

SCOPe Domain Coordinates for d3excx_:

Click to download the PDB-style file with coordinates for d3excx_.
(The format of our PDB-style files is described here.)

Timeline for d3excx_: