Lineage for d3ex7e_ (3ex7 E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008314Fold d.232: Mago nashi protein [89816] (1 superfamily)
    beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234
  4. 3008315Superfamily d.232.1: Mago nashi protein [89817] (1 family) (S)
    automatically mapped to Pfam PF02792
  5. 3008316Family d.232.1.1: Mago nashi protein [89818] (2 proteins)
  6. 3008317Protein Mago nashi protein [89819] (2 species)
  7. 3008323Species Human (Homo sapiens) [TaxId:9606] [102750] (5 PDB entries)
  8. 3008330Domain d3ex7e_: 3ex7 E: [175286]
    automated match to d1p27a_
    protein/RNA complex; complexed with adp, af3, mg

Details for d3ex7e_

PDB Entry: 3ex7 (more details), 2.3 Å

PDB Description: The crystal structure of EJC in its transition state
PDB Compounds: (E:) Protein mago nashi homolog

SCOPe Domain Sequences for d3ex7e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ex7e_ d.232.1.1 (E:) Mago nashi protein {Human (Homo sapiens) [TaxId: 9606]}
fylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelkrii
ddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrvfyy
lvqdlkclvfsliglhfkikpi

SCOPe Domain Coordinates for d3ex7e_:

Click to download the PDB-style file with coordinates for d3ex7e_.
(The format of our PDB-style files is described here.)

Timeline for d3ex7e_: