Lineage for d3ewfa_ (3ewf A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1850944Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 1850945Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 1851223Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. 1851257Protein automated matches [190786] (1 species)
    not a true protein
  7. 1851258Species Human (Homo sapiens) [TaxId:9606] [188039] (24 PDB entries)
  8. 1851276Domain d3ewfa_: 3ewf A: [175276]
    automated match to d1t64a_
    complexed with k, mcm, zn

Details for d3ewfa_

PDB Entry: 3ewf (more details), 2.5 Å

PDB Description: crystal structure analysis of human hdac8 h143a variant complexed with substrate.
PDB Compounds: (A:) Histone deacetylase 8

SCOPe Domain Sequences for d3ewfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ewfa_ c.42.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
aylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckv
ainwsggwhaakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsfts
kvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyq
afnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantar
cwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnl
khvv

SCOPe Domain Coordinates for d3ewfa_:

Click to download the PDB-style file with coordinates for d3ewfa_.
(The format of our PDB-style files is described here.)

Timeline for d3ewfa_: