SCOPe 2.06: Domain d3ewda1: 3ewd A:7-362

Lineage for d3ewda1 (3ewd A:7-362)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)

6. Protein automated matches [190078] (4 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:5855] [187988] (4 PDB entries)

8. Domain d3ewda1: 3ewd A:7-362 [175275]
   Other proteins in same PDB: d3ewda2
   automated match to d2amxa1
   complexed with mcf, zn; mutant

Details for d3ewda1

PDB Entry: 3ewd, 1.9 Å

PDB Description: crystal structure of adenosine deaminase mutant (delta asp172) from plasmodium vivax in complex with mt-coformycin

PDB Compounds: (A:) adenosine deaminase

SCOPe Domain Sequences for d3ewda1:

Sequence; same for both SEQRES and ATOM records:

>d3ewda1 c.1.9.1 (A:7-362) automated matches {Plasmodium vivax [TaxId: 5855]}
pidflkkeelknidlsqmskkerykiwkripkcelhchldlcfsadffvscirkynlqpn
lsdeevldyylfakggkslgefvekaikvadifhdyeviedlakhavfnkykegvvlmef
rysptfvafkynldielihqaivkgikevvelldhkihvalmcigtgheaanikasadfc
lkhkadfvgfdhgghevdlkeykeifdyvresgvplsvhagedvtlpnlntlysaiqvlk
verighgirvaesqelidmvkeknillevcpisnvllknaksmdthpirqlydagvkvsv
nsddpgmfltninddyeelythlnftledfmkmnewaleksfmdsnikdkiknlyf

Timeline for d3ewda1:

• d3ewda1 first appeared in SCOPe 2.01, called d3ewda_
  
• d3ewda1 was called d3ewda_ in SCOPe 2.05
  
• d3ewda1 appears in SCOPe 2.07
  
• d3ewda1 appears in the current release, SCOPe 2.08