Lineage for d3ewda1 (3ewd A:7-362)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084339Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 protein domains)
  6. 2084387Protein automated matches [190078] (4 species)
    not a true protein
  7. 2084396Species Plasmodium vivax [TaxId:5855] [187988] (4 PDB entries)
  8. 2084398Domain d3ewda1: 3ewd A:7-362 [175275]
    Other proteins in same PDB: d3ewda2
    automated match to d2amxa1
    complexed with mcf, zn; mutant

Details for d3ewda1

PDB Entry: 3ewd (more details), 1.9 Å

PDB Description: crystal structure of adenosine deaminase mutant (delta asp172) from plasmodium vivax in complex with mt-coformycin
PDB Compounds: (A:) adenosine deaminase

SCOPe Domain Sequences for d3ewda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ewda1 c.1.9.1 (A:7-362) automated matches {Plasmodium vivax [TaxId: 5855]}
pidflkkeelknidlsqmskkerykiwkripkcelhchldlcfsadffvscirkynlqpn
lsdeevldyylfakggkslgefvekaikvadifhdyeviedlakhavfnkykegvvlmef
rysptfvafkynldielihqaivkgikevvelldhkihvalmcigtgheaanikasadfc
lkhkadfvgfdhgghevdlkeykeifdyvresgvplsvhagedvtlpnlntlysaiqvlk
verighgirvaesqelidmvkeknillevcpisnvllknaksmdthpirqlydagvkvsv
nsddpgmfltninddyeelythlnftledfmkmnewaleksfmdsnikdkiknlyf

SCOPe Domain Coordinates for d3ewda1:

Click to download the PDB-style file with coordinates for d3ewda1.
(The format of our PDB-style files is described here.)

Timeline for d3ewda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ewda2