SCOPe 2.05: Domain d3ewca_: 3ewc A:

Lineage for d3ewca_ (3ewc A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)

6. Protein automated matches [190078] (4 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:5855] [187988] (4 PDB entries)

8. Domain d3ewca_: 3ewc A: [175274]
   automated match to d2amxa1
   complexed with mcf, zn

Details for d3ewca_

PDB Entry: 3ewc, 2.11 Å

PDB Description: Crystal Structure of adenosine deaminase from Plasmodial vivax in complex with MT-coformycin

PDB Compounds: (A:) adenosine deaminase

SCOPe Domain Sequences for d3ewca_:

Sequence; same for both SEQRES and ATOM records:

>d3ewca_ c.1.9.1 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
pidflkkeelknidlsqmskkerykiwkripkcelhchldlcfsadffvscirkynlqpn
lsdeevldyylfakggkslgefvekaikvadifhdyeviedlakhavfnkykegvvlmef
rysptfvafkynldielihqaivkgikevvelldhkihvalmcigdtgheaanikasadf
clkhkadfvgfdhgghevdlkeykeifdyvresgvplsvhagedvtlpnlntlysaiqvl
kverighgirvaesqelidmvkeknillevcpisnvllknaksmdthpirqlydagvkvs
vnsddpgmfltninddyeelythlnftledfmkmnewaleksfmdsnikdkiknlyf

Timeline for d3ewca_:

• d3ewca_ first appeared in SCOPe 2.01
  
• d3ewca_ appears in SCOPe 2.04
  
• d3ewca_ appears in SCOPe 2.06
  
• d3ewca_ appears in the current release, SCOPe 2.08