SCOPe 2.01: Domain d3evxd_: 3evx D:

Lineage for d3evxd_ (3evx D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.4: UFC1-like [143072] (2 proteins)

6. Protein Ufm1-conjugating enzyme 1, UFC1 [143073] (1 species)
   aka cgi-126

7. Species Human (Homo sapiens) [TaxId:9606] [143074] (4 PDB entries)
   Uniprot Q9Y3C8 1-167

8. Domain d3evxd_: 3evx D: [175270]
   automated match to d1ywza1
   complexed with scn

Details for d3evxd_

PDB Entry: 3evx, 2.54 Å

PDB Description: crystal structure of the human e2-like ubiquitin-fold modifier conjugating enzyme 1 (ufc1). northeast structural genomics consortium target hr41

PDB Compounds: (D:) Ufm1-conjugating enzyme 1

SCOPe Domain Sequences for d3evxd_:

Sequence; same for both SEQRES and ATOM records:

>d3evxd_ d.20.1.4 (D:) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]}
atrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnkegtr
wfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdhfkpl
warnvpkfglahlmalglgpwlaveipdliqkgviqhk

Timeline for d3evxd_:

• d3evxd_ is new in SCOPe 2.01-stable
  
• d3evxd_ appears in SCOPe 2.02
  
• d3evxd_ appears in the current release, SCOPe 2.08