SCOPe 2.07: Domain d3evxc_: 3evx C:

Lineage for d3evxc_ (3evx C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.4: UFC1-like [143072] (2 proteins)
   automatically mapped to Pfam PF08694

6. Protein Ufm1-conjugating enzyme 1, UFC1 [143073] (1 species)
   aka cgi-126

7. Species Human (Homo sapiens) [TaxId:9606] [143074] (7 PDB entries)
   Uniprot Q9Y3C8 1-167

8. Domain d3evxc_: 3evx C: [175269]
   automated match to d1ywza1
   complexed with scn

Details for d3evxc_

PDB Entry: 3evx, 2.54 Å

PDB Description: crystal structure of the human e2-like ubiquitin-fold modifier conjugating enzyme 1 (ufc1). northeast structural genomics consortium target hr41

PDB Compounds: (C:) Ufm1-conjugating enzyme 1

SCOPe Domain Sequences for d3evxc_:

Sequence; same for both SEQRES and ATOM records:

>d3evxc_ d.20.1.4 (C:) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]}
atrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnkegtr
wfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdhfkpl
warnvpkfglahlmalglgpwlaveipdliqkgviqhk

Timeline for d3evxc_:

• d3evxc_ first appeared in SCOPe 2.01
  
• d3evxc_ appears in SCOPe 2.06
  
• d3evxc_ appears in the current release, SCOPe 2.08