Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein automated matches [190032] (18 species) not a true protein |
Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries) |
Domain d3evwf1: 3evw F:2-129 [175266] Other proteins in same PDB: d3evwa2, d3evwb2, d3evwc2, d3evwd2, d3evwe2, d3evwf2 automated match to d2b8pa1 complexed with mg, tyd; mutant |
PDB Entry: 3evw (more details), 2.6 Å
SCOPe Domain Sequences for d3evwf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3evwf1 d.58.6.1 (F:2-129) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]} qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandigenlihasdsedsav deisiwfp
Timeline for d3evwf1: