Lineage for d3evlb_ (3evl B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 920404Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 920657Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 920658Family a.102.3.1: Alginate lyase A1-III [48231] (1 protein)
  6. 920659Protein Alginate lyase A1-III [48232] (1 species)
  7. 920660Species Sphingomonas sp., A1 [TaxId:28214] [48233] (5 PDB entries)
  8. 920668Domain d3evlb_: 3evl B: [175254]
    automated match to d1hv6a_

Details for d3evlb_

PDB Entry: 3evl (more details), 2.2 Å

PDB Description: Alginate lyase A1-III H192A complexed with tetrasaccharide
PDB Compounds: (B:) Alginate lyase

SCOPe Domain Sequences for d3evlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3evlb_ a.102.3.1 (B:) Alginate lyase A1-III {Sphingomonas sp., A1 [TaxId: 28214]}
gshpfdqavvkdptasyvdvkarrtflqsgqlddrlkaalpkeydctteatpnpqqgemv
iprrylsgnhgpvnpdyepvvtlyrdfekisatlgnlyvatgkpvyatcllnmldkwaka
dallnydpksqswyqvewsaataafalstmmaepnvdtaqrervvkwlnrvarhqtsfpg
gdtsccnnasywrgqeatiigviskddelfrwglgryvqamglinedgsfvhemtrheqs
lhyqnyamlpltmiaetasrqgidlyaykengrdihsarkfvfaavknpdlikkyasepq
dtrafkpgrgdlnwieyqrarfgfadelgfmtvpifdprtggsatllaykpq

SCOPe Domain Coordinates for d3evlb_:

Click to download the PDB-style file with coordinates for d3evlb_.
(The format of our PDB-style files is described here.)

Timeline for d3evlb_:

  • d3evlb_ is new in SCOPe 2.01-stable
  • d3evlb_ does not appear in SCOPe 2.02

View in 3D
Domains from other chains:
(mouse over for more information)
d3evla_