![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Yellow fever virus [TaxId:11090] [188732] (6 PDB entries) |
![]() | Domain d3evda_: 3evd A: [175247] automated match to d1r6aa_ protein/RNA complex; complexed with gtp, sah |
PDB Entry: 3evd (more details), 1.5 Å
SCOPe Domain Sequences for d3evda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3evda_ c.66.1.0 (A:) automated matches {Yellow fever virus [TaxId: 11090]} ktlgevwkrelnlldkrqfelykrtdivevdrdtarrhlaegkvdtgvavsrgtaklrwf hergyvklegrvidlgcgrggwcyyaaaqkevsgvkgftlgrdghekpmnvqslgwniit fkdktdihrlepvkcdtllcdigesssssvtegertvrvldtvekwlacgvdnfcvkvla pympdvleklellqrrfggtvirnplsrnsthemyyvsgarsnvtftvnqtsrllmrrmr rptgkvtleadvilpigtrsv
Timeline for d3evda_: