Lineage for d3evaa_ (3eva A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502800Species Yellow fever virus [TaxId:11090] [188732] (6 PDB entries)
  8. 2502802Domain d3evaa_: 3eva A: [175244]
    automated match to d1r6aa_
    protein/RNA complex; complexed with sah

Details for d3evaa_

PDB Entry: 3eva (more details), 1.5 Å

PDB Description: Crystal structure of yellow fever virus methyltransferase complexed with S-adenosyl-L-homocysteine
PDB Compounds: (A:) RNA-directed RNA polymerase NS5

SCOPe Domain Sequences for d3evaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3evaa_ c.66.1.0 (A:) automated matches {Yellow fever virus [TaxId: 11090]}
ktlgevwkrelnlldkrqfelykrtdivevdrdtarrhlaegkvdtgvavsrgtaklrwf
hergyvklegrvidlgcgrggwcyyaaaqkevsgvkgftlgrdghekpmnvqslgwniit
fkdktdihrlepvkcdtllcdigesssssvtegertvrvldtvekwlacgvdnfcvkvla
pympdvleklellqrrfggtvirnplsrnsthemyyvsgarsnvtftvnqtsrllmrrmr
rptgkvtleadvilpigtrsv

SCOPe Domain Coordinates for d3evaa_:

Click to download the PDB-style file with coordinates for d3evaa_.
(The format of our PDB-style files is described here.)

Timeline for d3evaa_: