Lineage for d3euvb_ (3euv B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004426Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2004554Family a.102.4.3: Protein prenyltransferases [48246] (3 protein domains)
  6. 2004695Protein automated matches [191067] (1 species)
    not a true protein
  7. 2004696Species Norway rat (Rattus norvegicus) [TaxId:10116] [188971] (2 PDB entries)
  8. 2004698Domain d3euvb_: 3euv B: [175223]
    Other proteins in same PDB: d3euva_
    automated match to d1jcqb_
    complexed with gbo, zn

Details for d3euvb_

PDB Entry: 3euv (more details), 2.75 Å

PDB Description: crystal structure of ftase(alpha-subunit; beta-subunit delta c10, w102t, y154t) in complex with biotingpp
PDB Compounds: (B:) Protein farnesyltransferase subunit beta

SCOPe Domain Sequences for d3euvb_:

Sequence, based on SEQRES records: (download)

>d3euvb_ a.102.4.3 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfh
ylkrglrqltdayecldasrptlcywilhslelldepipqivatdvcqflelcqspdggf
gggpgqyphlapttaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevd
vrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalv
ilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgd
palsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsga
mlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgfe

Sequence, based on observed residues (ATOM records): (download)

>d3euvb_ a.102.4.3 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnvprlvlqrekhfhyl
krglrqltdayecldasrptlcywilhslelldepipqivatdvcqflelcqspdggfgg
gpgqyphlapttaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr
saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil
kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa
lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml
hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgfe

SCOPe Domain Coordinates for d3euvb_:

Click to download the PDB-style file with coordinates for d3euvb_.
(The format of our PDB-style files is described here.)

Timeline for d3euvb_: