Lineage for d3euna_ (3eun A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949056Family d.58.1.1: Short-chain ferredoxins [54863] (2 proteins)
    contains two 4Fe-4S clusters
  6. 2949070Protein automated matches [190638] (3 species)
    not a true protein
  7. 2949071Species Allochromatium vinosum [TaxId:1049] [188869] (2 PDB entries)
  8. 2949072Domain d3euna_: 3eun A: [175222]
    automated match to d1blua_
    complexed with sf4

Details for d3euna_

PDB Entry: 3eun (more details), 1.05 Å

PDB Description: crystal structure of the 2[4fe-4s] c57a ferredoxin variant from allochromatium vinosum
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d3euna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3euna_ d.58.1.1 (A:) automated matches {Allochromatium vinosum [TaxId: 1049]}
almitdecincdvcepecpngaisqgdetyviepslctecvghyetsqcvevcpvdaiik
dpsheetedelrakyeritge

SCOPe Domain Coordinates for d3euna_:

Click to download the PDB-style file with coordinates for d3euna_.
(The format of our PDB-style files is described here.)

Timeline for d3euna_: