SCOPe 2.02: Domain d3etpa_: 3etp A:

Lineage for d3etpa_ (3etp A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)

6. Protein Ligand-binding domain of the ephb2 receptor tyrosine kinase [49801] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49802] (4 PDB entries)
   Uniprot P54763 27-207

8. Domain d3etpa_: 3etp A: [175216]
   automated match to d1kgya_

Details for d3etpa_

PDB Entry: 3etp, 2 Å

PDB Description: the crystal structure of the ligand-binding domain of the ephb2 receptor at 2.0 a resolution

PDB Compounds: (A:) ephrin type-b receptor 2

SCOPe Domain Sequences for d3etpa_:

Sequence; same for both SEQRES and ATOM records:

>d3etpa_ b.18.1.4 (A:) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
amaisdpeetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnw
lrtkfirrrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwme
npwvkvdtiaadesisqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrv
fyrkcpr

Timeline for d3etpa_:

• d3etpa_ first appeared in SCOPe 2.01
  
• d3etpa_ appears in SCOPe 2.03
  
• d3etpa_ appears in the current release, SCOPe 2.08, called d3etpa1