Lineage for d3etpa_ (3etp A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 942101Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 942102Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 942170Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
  6. 942175Protein Ligand-binding domain of the ephb2 receptor tyrosine kinase [49801] (1 species)
  7. 942176Species Mouse (Mus musculus) [TaxId:10090] [49802] (4 PDB entries)
    Uniprot P54763 27-207
  8. 942177Domain d3etpa_: 3etp A: [175216]
    automated match to d1kgya_

Details for d3etpa_

PDB Entry: 3etp (more details), 2 Å

PDB Description: the crystal structure of the ligand-binding domain of the ephb2 receptor at 2.0 a resolution
PDB Compounds: (A:) ephrin type-b receptor 2

SCOPe Domain Sequences for d3etpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etpa_ b.18.1.4 (A:) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
amaisdpeetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnw
lrtkfirrrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwme
npwvkvdtiaadesisqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrv
fyrkcpr

SCOPe Domain Coordinates for d3etpa_:

Click to download the PDB-style file with coordinates for d3etpa_.
(The format of our PDB-style files is described here.)

Timeline for d3etpa_: