SCOPe 2.08: Domain d3etpa1: 3etp A:28-207

Lineage for d3etpa1 (3etp A:28-207)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
   automatically mapped to Pfam PF01404

6. Protein Ligand-binding domain of the ephb2 receptor tyrosine kinase [49801] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49802] (4 PDB entries)
   Uniprot P54763 27-207

8. Domain d3etpa1: 3etp A:28-207 [175216]
   Other proteins in same PDB: d3etpa2
   automated match to d1kgya_

Details for d3etpa1

PDB Entry: 3etp, 2 Å

PDB Description: the crystal structure of the ligand-binding domain of the ephb2 receptor at 2.0 a resolution

PDB Compounds: (A:) ephrin type-b receptor 2

SCOPe Domain Sequences for d3etpa1:

Sequence; same for both SEQRES and ATOM records:

>d3etpa1 b.18.1.4 (A:28-207) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
eetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfir
rrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkvd
tiaadesisqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyrkcpr

Timeline for d3etpa1:

• d3etpa1 first appeared in SCOPe 2.01, called d3etpa_
  
• d3etpa1 appears in SCOPe 2.07