| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins) automatically mapped to Pfam PF01404 |
| Protein Ligand-binding domain of the ephb2 receptor tyrosine kinase [49801] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [49802] (4 PDB entries) Uniprot P54763 27-207 |
| Domain d3etpa1: 3etp A:28-207 [175216] Other proteins in same PDB: d3etpa2 automated match to d1kgya_ |
PDB Entry: 3etp (more details), 2 Å
SCOPe Domain Sequences for d3etpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etpa1 b.18.1.4 (A:28-207) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
eetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfir
rrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkvd
tiaadesisqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyrkcpr
Timeline for d3etpa1: