Lineage for d3etab_ (3eta B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543981Protein Insulin receptor [56162] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 2543982Species Human (Homo sapiens) [TaxId:9606] [56163] (18 PDB entries)
  8. 2543998Domain d3etab_: 3eta B: [175213]
    automated match to d1gaga_
    complexed with 351

Details for d3etab_

PDB Entry: 3eta (more details), 2.6 Å

PDB Description: kinase domain of insulin receptor complexed with a pyrrolo pyridine inhibitor
PDB Compounds: (B:) insulin receptor, kinase domain

SCOPe Domain Sequences for d3etab_:

Sequence, based on SEQRES records: (download)

>d3etab_ d.144.1.7 (B:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
evsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslrerieflneas
vmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptlqem
iqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkggkg
llpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdggyld
qpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhseenk

Sequence, based on observed residues (ATOM records): (download)

>d3etab_ d.144.1.7 (B:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
evsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslrerieflneas
vmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptlqem
iqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkkgll
pvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdggyldqp
dncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhseenk

SCOPe Domain Coordinates for d3etab_:

Click to download the PDB-style file with coordinates for d3etab_.
(The format of our PDB-style files is described here.)

Timeline for d3etab_: