Lineage for d8gssa1 (8gss A:77-209)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713204Protein Class pi GST [81347] (4 species)
  7. 2713205Species Human (Homo sapiens) [TaxId:9606] [47619] (67 PDB entries)
  8. 2713277Domain d8gssa1: 8gss A:77-209 [17521]
    Other proteins in same PDB: d8gssa2, d8gssb2, d8gssc2
    complexed with gsh, mes, so4

Details for d8gssa1

PDB Entry: 8gss (more details), 1.9 Å

PDB Description: Human glutathione S-transferase P1-1, complex with glutathione
PDB Compounds: (A:) glutathione s-transferase p1-1

SCOPe Domain Sequences for d8gssa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8gssa1 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d8gssa1:

Click to download the PDB-style file with coordinates for d8gssa1.
(The format of our PDB-style files is described here.)

Timeline for d8gssa1: