Lineage for d3et2a_ (3et2 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009141Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 2009142Species Human (Homo sapiens) [TaxId:9606] [48527] (16 PDB entries)
  8. 2009149Domain d3et2a_: 3et2 A: [175209]
    automated match to d1gwxa_
    complexed with 1bo, et1

Details for d3et2a_

PDB Entry: 3et2 (more details), 2.24 Å

PDB Description: structure of ppardelta with 3-[5-methoxy-1-(4-methoxy- benzenesulfonyl)-1h-indol-3-yl]-propionic acid
PDB Compounds: (A:) Peroxisome proliferator-activated receptor delta

SCOPe Domain Sequences for d3et2a_:

Sequence, based on SEQRES records: (download)

>d3et2a_ a.123.1.1 (A:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
vadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkql
vnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaif
amlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalf
iaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvt
ehaqmmqrikktetetslhpllqeiykdm

Sequence, based on observed residues (ATOM records): (download)

>d3et2a_ a.123.1.1 (A:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
vadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwvng
lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvteha
qmmqrikktetetslhpllqeiykdm

SCOPe Domain Coordinates for d3et2a_:

Click to download the PDB-style file with coordinates for d3et2a_.
(The format of our PDB-style files is described here.)

Timeline for d3et2a_: