![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (9 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein Hop [48456] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48457] (4 PDB entries) |
![]() | Domain d3eska1: 3esk A:223-349 [175194] Other proteins in same PDB: d3eska2 automated match to d1elra_ complexed with ni |
PDB Entry: 3esk (more details), 2.05 Å
SCOPe Domain Sequences for d3eska1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eska1 a.118.8.1 (A:223-349) Hop {Human (Homo sapiens) [TaxId: 9606]} kqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrelc ekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqqa ekilkeq
Timeline for d3eska1: