SCOPe 2.04: Domain d3eska_: 3esk A:

Lineage for d3eska_ (3esk A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Hop [48456] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48457] (3 PDB entries)

8. Domain d3eska_: 3esk A: [175194]
   automated match to d1elra_
   complexed with ni

Details for d3eska_

PDB Entry: 3esk, 2.05 Å

PDB Description: Structure of HOP TPR2A domain in complex with the non-cognate Hsc70 peptide ligand

PDB Compounds: (A:) Stress-induced-phosphoprotein 1

SCOPe Domain Sequences for d3eska_:

Sequence; same for both SEQRES and ATOM records:

>d3eska_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}
gkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrel
cekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqq
aekilkeq

Timeline for d3eska_:

• d3eska_ first appeared in SCOPe 2.01
  
• d3eska_ appears in SCOPe 2.03
  
• d3eska_ appears in SCOPe 2.05
  
• d3eska_ appears in the current release, SCOPe 2.08, called d3eska1