Lineage for d3eska_ (3esk A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1096244Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1096245Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 1096263Protein Hop [48456] (1 species)
  7. 1096264Species Human (Homo sapiens) [TaxId:9606] [48457] (3 PDB entries)
  8. 1096268Domain d3eska_: 3esk A: [175194]
    automated match to d1elra_
    complexed with ni

Details for d3eska_

PDB Entry: 3esk (more details), 2.05 Å

PDB Description: Structure of HOP TPR2A domain in complex with the non-cognate Hsc70 peptide ligand
PDB Compounds: (A:) Stress-induced-phosphoprotein 1

SCOPe Domain Sequences for d3eska_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eska_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}
gkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrel
cekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqq
aekilkeq

SCOPe Domain Coordinates for d3eska_:

Click to download the PDB-style file with coordinates for d3eska_.
(The format of our PDB-style files is described here.)

Timeline for d3eska_: