SCOPe 2.08: Domain d3eska1: 3esk A:223-349

Lineage for d3eska1 (3esk A:223-349)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Hop [48456] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48457] (4 PDB entries)

8. Domain d3eska1: 3esk A:223-349 [175194]
   Other proteins in same PDB: d3eska2
   automated match to d1elra_
   complexed with ni

Details for d3eska1

PDB Entry: 3esk, 2.05 Å

PDB Description: Structure of HOP TPR2A domain in complex with the non-cognate Hsc70 peptide ligand

PDB Compounds: (A:) Stress-induced-phosphoprotein 1

SCOPe Domain Sequences for d3eska1:

Sequence; same for both SEQRES and ATOM records:

>d3eska1 a.118.8.1 (A:223-349) Hop {Human (Homo sapiens) [TaxId: 9606]}
kqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrelc
ekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqqa
ekilkeq

Timeline for d3eska1:

• d3eska1 first appeared in SCOPe 2.01, called d3eska_
  
• d3eska1 appears in SCOPe 2.07