Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (20 species) not a true protein |
Species Pseudomonas fluorescens [TaxId:216595] [189073] (1 PDB entry) |
Domain d3esgb_: 3esg B: [175192] automated match to d1ylla1 complexed with fmt, gol |
PDB Entry: 3esg (more details), 1.8 Å
SCOPe Domain Sequences for d3esgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3esgb_ b.82.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 216595]} saisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggfssfagyqr vitviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliysperyhar lqwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisvtgrcclie ltqrg
Timeline for d3esgb_: