| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.30: Cutinase-like [52260] (3 proteins) minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold automatically mapped to Pfam PF01083 |
| Protein automated matches [191066] (4 species) not a true protein |
| Species Fusarium solani [TaxId:70791] [188966] (5 PDB entries) |
| Domain d3esca_: 3esc A: [175189] automated match to d2cuta_ complexed with sxc |
PDB Entry: 3esc (more details), 1.2 Å
SCOPe Domain Sequences for d3esca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3esca_ c.69.1.30 (A:) automated matches {Fusarium solani [TaxId: 70791]}
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpdar
gpapefliekvravr
Timeline for d3esca_: