Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.30: Cutinase-like [52260] (3 proteins) minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold automatically mapped to Pfam PF01083 |
Protein automated matches [191066] (4 species) not a true protein |
Species Fusarium solani [TaxId:70791] [188966] (5 PDB entries) |
Domain d3esba_: 3esb A: [175188] automated match to d2cuta_ complexed with cl, nxc |
PDB Entry: 3esb (more details), 2.3 Å
SCOPe Domain Sequences for d3esba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3esba_ c.69.1.30 (A:) automated matches {Fusarium solani [TaxId: 70791]} grttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgg ayratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedlds airdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpda rgpapefliekvravrgsa
Timeline for d3esba_: