Lineage for d3esab_ (3esa B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901665Family c.69.1.30: Cutinase-like [52260] (3 proteins)
    minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold
    automatically mapped to Pfam PF01083
  6. 2901720Protein automated matches [191066] (4 species)
    not a true protein
  7. 2901727Species Fusarium solani [TaxId:70791] [188966] (5 PDB entries)
  8. 2901732Domain d3esab_: 3esa B: [175187]
    automated match to d2cuta_
    complexed with nxc

Details for d3esab_

PDB Entry: 3esa (more details), 2 Å

PDB Description: cut-1b; ncn-pt-pincer-cutinase hybrid
PDB Compounds: (B:) Cutinase 1

SCOPe Domain Sequences for d3esab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3esab_ c.69.1.30 (B:) automated matches {Fusarium solani [TaxId: 70791]}
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpdar
gpapefliekvravrgsa

SCOPe Domain Coordinates for d3esab_:

Click to download the PDB-style file with coordinates for d3esab_.
(The format of our PDB-style files is described here.)

Timeline for d3esab_: