SCOPe 2.03: Domain d3erwf_: 3erw F:

Lineage for d3erwf_ (3erw F:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188752] (2 PDB entries)

8. Domain d3erwf_: 3erw F: [175182]
   automated match to d1st9a_

Details for d3erwf_

PDB Entry: 3erw, 2.5 Å

PDB Description: Crystal Structure of StoA from Bacillus subtilis

PDB Compounds: (F:) Sporulation thiol-disulfide oxidoreductase A

SCOPe Domain Sequences for d3erwf_:

Sequence; same for both SEQRES and ATOM records:

>d3erwf_ c.47.1.0 (F:) automated matches {Bacillus subtilis [TaxId: 1423]}
pavflmktiegedisipnkgqktilhfwtswcppckkelpqfqsfydahpsdsvklvtvn
lvnseqnqqvvedfikankltfpivldskgelmkeyhiitiptsfllnekgeiektkigp
mtaeqlkewte

Timeline for d3erwf_:

• d3erwf_ first appeared in SCOPe 2.01
  
• d3erwf_ appears in SCOPe 2.02
  
• d3erwf_ appears in SCOPe 2.04
  
• d3erwf_ appears in the current release, SCOPe 2.08