Lineage for d3erwf_ (3erw F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879094Species Bacillus subtilis [TaxId:1423] [188752] (4 PDB entries)
  8. 2879102Domain d3erwf_: 3erw F: [175182]
    automated match to d1st9a_

Details for d3erwf_

PDB Entry: 3erw (more details), 2.5 Å

PDB Description: Crystal Structure of StoA from Bacillus subtilis
PDB Compounds: (F:) Sporulation thiol-disulfide oxidoreductase A

SCOPe Domain Sequences for d3erwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3erwf_ c.47.1.0 (F:) automated matches {Bacillus subtilis [TaxId: 1423]}
pavflmktiegedisipnkgqktilhfwtswcppckkelpqfqsfydahpsdsvklvtvn
lvnseqnqqvvedfikankltfpivldskgelmkeyhiitiptsfllnekgeiektkigp
mtaeqlkewte

SCOPe Domain Coordinates for d3erwf_:

Click to download the PDB-style file with coordinates for d3erwf_.
(The format of our PDB-style files is described here.)

Timeline for d3erwf_: