SCOPe 2.05: Domain d3erwb_: 3erw B:

Lineage for d3erwb_ (3erw B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188752] (4 PDB entries)

8. Domain d3erwb_: 3erw B: [175178]
   automated match to d1st9a_

Details for d3erwb_

PDB Entry: 3erw, 2.5 Å

PDB Description: Crystal Structure of StoA from Bacillus subtilis

PDB Compounds: (B:) Sporulation thiol-disulfide oxidoreductase A

SCOPe Domain Sequences for d3erwb_:

Sequence; same for both SEQRES and ATOM records:

>d3erwb_ c.47.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
pavpavflmktiegedisipnkgqktilhfwtswcppckkelpqfqsfydahpsdsvklv
tvnlvnseqnqqvvedfikankltfpivldskgelmkeyhiitiptsfllnekgeiektk
igpmtaeqlkewte

Timeline for d3erwb_:

• d3erwb_ first appeared in SCOPe 2.01
  
• d3erwb_ appears in SCOPe 2.04
  
• d3erwb_ appears in SCOPe 2.06
  
• d3erwb_ appears in the current release, SCOPe 2.08