SCOPe 2.01: Domain d3erwa_: 3erw A:

Lineage for d3erwa_ (3erw A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (35 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188752] (2 PDB entries)

8. Domain d3erwa_: 3erw A: [175177]
   automated match to d1st9a_

Details for d3erwa_

PDB Entry: 3erw, 2.5 Å

PDB Description: Crystal Structure of StoA from Bacillus subtilis

PDB Compounds: (A:) Sporulation thiol-disulfide oxidoreductase A

SCOPe Domain Sequences for d3erwa_:

Sequence; same for both SEQRES and ATOM records:

>d3erwa_ c.47.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
pavpavflmktiegedisipnkgqktilhfwtswcppckkelpqfqsfydahpsdsvklv
tvnlvnseqnqqvvedfikankltfpivldskgelmkeyhiitiptsfllnekgeiektk
igpmtaeqlkewte

Timeline for d3erwa_:

• d3erwa_ is new in SCOPe 2.01-stable
  
• d3erwa_ appears in SCOPe 2.02
  
• d3erwa_ appears in the current release, SCOPe 2.08