| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [188752] (4 PDB entries) |
| Domain d3erwa_: 3erw A: [175177] automated match to d1st9a_ |
PDB Entry: 3erw (more details), 2.5 Å
SCOPe Domain Sequences for d3erwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3erwa_ c.47.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
pavpavflmktiegedisipnkgqktilhfwtswcppckkelpqfqsfydahpsdsvklv
tvnlvnseqnqqvvedfikankltfpivldskgelmkeyhiitiptsfllnekgeiektk
igpmtaeqlkewte
Timeline for d3erwa_: