Lineage for d3eqba1 (3eqb A:62-382)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2587519Protein Dual specificity mitogen-activated protein kinase kinase 1, Mek1 [118137] (2 species)
    OPK group (?); MAPKK subfamily; serine/threonine kinase
  7. 2587520Species Human (Homo sapiens) [TaxId:9606] [118138] (42 PDB entries)
    Uniprot Q02750 61-381
  8. 2587539Domain d3eqba1: 3eqb A:62-382 [175155]
    Other proteins in same PDB: d3eqba2
    automated match to d1s9ja_
    protein/RNA complex; complexed with atp, lug, mg

Details for d3eqba1

PDB Entry: 3eqb (more details), 2.62 Å

PDB Description: X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in a complex with ligand and MgATP
PDB Compounds: (A:) Dual specificity mitogen-activated protein kinase kinase 1

SCOPe Domain Sequences for d3eqba1:

Sequence, based on SEQRES records: (download)

>d3eqba1 d.144.1.7 (A:62-382) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]}
elkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhec
nspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltylr
ekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthys
vqsdiwsmglslvemavgrypipppdakelelmfgcqvegdaaetpprprtpgrplssyg
mdsrppmaifelldyivnepppklpsgvfslefqdfvnkcliknpaeradlkqlmvhafi
krsdaeevdfagwlcstigln

Sequence, based on observed residues (ATOM records): (download)

>d3eqba1 d.144.1.7 (A:62-382) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]}
elkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhec
nspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltylr
ekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmavgtrsymsperlqgthysvqs
diwsmglslvemavgrypipppdakelelmfppmaifelldyivnepppklpsgvfslef
qdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstigln

SCOPe Domain Coordinates for d3eqba1:

Click to download the PDB-style file with coordinates for d3eqba1.
(The format of our PDB-style files is described here.)

Timeline for d3eqba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3eqba2