Lineage for d3epwb_ (3epw B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903313Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2903314Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2903315Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins)
    automatically mapped to Pfam PF01156
  6. 2903356Protein automated matches [190287] (4 species)
    not a true protein
  7. 2903376Species Trypanosoma vivax [TaxId:5699] [187091] (5 PDB entries)
  8. 2903378Domain d3epwb_: 3epw B: [175149]
    automated match to d1hoza_
    complexed with ca, jmq, mg

Details for d3epwb_

PDB Entry: 3epw (more details), 1.3 Å

PDB Description: crystal structure of trypanosoma vivax nucleoside hydrolase in complex with the inhibitor (2r,3r,4s)-1-[(4-hydroxy-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl]-2-(hydroxymethyl)pyrrolidin-3,4-diol
PDB Compounds: (B:) IAG-nucleoside hydrolase

SCOPe Domain Sequences for d3epwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3epwb_ c.70.1.1 (B:) automated matches {Trypanosoma vivax [TaxId: 5699]}
aknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm
nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll
adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg
taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm
wamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaen
ypltfvarnpeaeffldmllrsarac

SCOPe Domain Coordinates for d3epwb_:

Click to download the PDB-style file with coordinates for d3epwb_.
(The format of our PDB-style files is described here.)

Timeline for d3epwb_: