SCOPe 2.05: Domain d3epra_: 3epr A:

Lineage for d3epra_ (3epr A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.14: NagD-like [102317] (7 proteins)
   duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family

6. Protein automated matches [190164] (2 species)
   not a true protein

7. Species Streptococcus agalactiae [TaxId:216466] [188652] (1 PDB entry)

8. Domain d3epra_: 3epr A: [175145]
   automated match to d1ys9a1
   complexed with gol, na

Details for d3epra_

PDB Entry: 3epr, 1.55 Å

PDB Description: crystal structure of putative had superfamily hydrolase from streptococcus agalactiae.

PDB Compounds: (A:) Hydrolase, haloacid dehalogenase-like family

SCOPe Domain Sequences for d3epra_:

Sequence; same for both SEQRES and ATOM records:

>d3epra_ c.108.1.14 (A:) automated matches {Streptococcus agalactiae [TaxId: 216466]}
slaykgylidldgtiykgksripagerfierlqekgipymlvtnnttrtpesvqemlrgf
nvetpletiytatmatvdymndmnrgktayvigeeglkkaiadagyvedtknpayvvvgl
dwnvtydklatatlaiqngalfigtnpdlniptergllpgagslnalleaatrikpvfig
kpnaiimnkaleilniprnqavmvgdnyltdimaginndidtllvttgfttveevpdlpi
qpsyvlasldewtfneghhh

Timeline for d3epra_:

• d3epra_ first appeared in SCOPe 2.01
  
• d3epra_ appears in SCOPe 2.04
  
• d3epra_ is called d3epra1 in SCOPe 2.06
  
• d3epra_ appears in the current release, SCOPe 2.08, called d3epra1