Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.14: NagD-like [102317] (7 proteins) duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family |
Protein automated matches [190164] (2 species) not a true protein |
Species Streptococcus agalactiae [TaxId:216466] [188652] (1 PDB entry) |
Domain d3epra_: 3epr A: [175145] automated match to d1ys9a1 complexed with gol, na |
PDB Entry: 3epr (more details), 1.55 Å
SCOPe Domain Sequences for d3epra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3epra_ c.108.1.14 (A:) automated matches {Streptococcus agalactiae [TaxId: 216466]} slaykgylidldgtiykgksripagerfierlqekgipymlvtnnttrtpesvqemlrgf nvetpletiytatmatvdymndmnrgktayvigeeglkkaiadagyvedtknpayvvvgl dwnvtydklatatlaiqngalfigtnpdlniptergllpgagslnalleaatrikpvfig kpnaiimnkaleilniprnqavmvgdnyltdimaginndidtllvttgfttveevpdlpi qpsyvlasldewtfneghhh
Timeline for d3epra_: