Lineage for d3epra_ (3epr A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010738Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1010739Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1011126Family c.108.1.14: NagD-like [102317] (7 proteins)
    duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family
  6. 1011149Protein automated matches [190164] (2 species)
    not a true protein
  7. 1011152Species Streptococcus agalactiae [TaxId:216466] [188652] (1 PDB entry)
  8. 1011153Domain d3epra_: 3epr A: [175145]
    automated match to d1ys9a1
    complexed with gol, na

Details for d3epra_

PDB Entry: 3epr (more details), 1.55 Å

PDB Description: crystal structure of putative had superfamily hydrolase from streptococcus agalactiae.
PDB Compounds: (A:) Hydrolase, haloacid dehalogenase-like family

SCOPe Domain Sequences for d3epra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3epra_ c.108.1.14 (A:) automated matches {Streptococcus agalactiae [TaxId: 216466]}
slaykgylidldgtiykgksripagerfierlqekgipymlvtnnttrtpesvqemlrgf
nvetpletiytatmatvdymndmnrgktayvigeeglkkaiadagyvedtknpayvvvgl
dwnvtydklatatlaiqngalfigtnpdlniptergllpgagslnalleaatrikpvfig
kpnaiimnkaleilniprnqavmvgdnyltdimaginndidtllvttgfttveevpdlpi
qpsyvlasldewtfneghhh

SCOPe Domain Coordinates for d3epra_:

Click to download the PDB-style file with coordinates for d3epra_.
(The format of our PDB-style files is described here.)

Timeline for d3epra_: