Lineage for d3eoog_ (3eoo G:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1149203Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 1149348Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (4 proteins)
    forms a swapped dimer
  6. 1149406Protein automated matches [190974] (2 species)
    not a true protein
  7. 1149407Species Burkholderia pseudomallei [TaxId:331109] [188638] (1 PDB entry)
  8. 1149414Domain d3eoog_: 3eoo G: [175127]
    automated match to d1oqfa_

Details for d3eoog_

PDB Entry: 3eoo (more details), 2.9 Å

PDB Description: 2.9A crystal structure of methyl-isocitrate lyase from Burkholderia pseudomallei
PDB Compounds: (G:) Methylisocitrate lyase

SCOPe Domain Sequences for d3eoog_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eoog_ c.1.12.7 (G:) automated matches {Burkholderia pseudomallei [TaxId: 331109]}
lisagakfraavaaeqplqvvgaitayaakmaeavgfkavylsgggvaanslgipdlgis
tmddvlvdanritnatnlpllvdidtgwggafniartirsfikagvgavhledqvgqkrc
ghrpgkecvpagemvdrikaavdartdetfvimartdaaaaegidaaieraiayveagad
mifpeamktlddyrrfkeavkvpilanltefgstplftldelkganvdialyccgayram
nkaalnfyetvrrdgtqkaavptmqtraqlydylgyyayeekldqlf

SCOPe Domain Coordinates for d3eoog_:

Click to download the PDB-style file with coordinates for d3eoog_.
(The format of our PDB-style files is described here.)

Timeline for d3eoog_: