Class a: All alpha proteins [46456] (285 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (38 species) not a true protein |
Species Duck (Anas platyrhynchos) [TaxId:8839] [189063] (1 PDB entry) |
Domain d3eokb_: 3eok B: [175120] automated match to d1hbrd_ complexed with hem |
PDB Entry: 3eok (more details), 2.1 Å
SCOPe Domain Sequences for d3eokb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eokb_ a.1.1.2 (B:) automated matches {Duck (Anas platyrhynchos) [TaxId: 8839]} vhwtaeekqlitglwgkvnvadcgaealarllivypwtqrffasfgnlssptailgnpmv rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahftk dftpecqaawqklvrvvahalarkyh
Timeline for d3eokb_: