SCOPe 2.04: Domain d3eokb_: 3eok B:

Lineage for d3eokb_ (3eok B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (38 species)
   not a true protein

7. Species Duck (Anas platyrhynchos) [TaxId:8839] [189063] (1 PDB entry)

8. Domain d3eokb_: 3eok B: [175120]
   automated match to d1hbrd_
   complexed with hem

Details for d3eokb_

PDB Entry: 3eok, 2.1 Å

PDB Description: crystal structure determination of duck (anas platyrhynchos) hemoglobin at 2.1 angstrom resolution

PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3eokb_:

Sequence; same for both SEQRES and ATOM records:

>d3eokb_ a.1.1.2 (B:) automated matches {Duck (Anas platyrhynchos) [TaxId: 8839]}
vhwtaeekqlitglwgkvnvadcgaealarllivypwtqrffasfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahftk
dftpecqaawqklvrvvahalarkyh

Timeline for d3eokb_:

• d3eokb_ first appeared in SCOPe 2.01
  
• d3eokb_ appears in SCOPe 2.03
  
• d3eokb_ appears in SCOPe 2.05
  
• d3eokb_ appears in the current release, SCOPe 2.08