SCOPe 2.08: Domain d3eoka_: 3eok A:

Lineage for d3eoka_ (3eok A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (43 species)
   not a true protein

7. Species Duck (Anas platyrhynchos) [TaxId:8839] [189063] (1 PDB entry)

8. Domain d3eoka_: 3eok A: [175119]
   automated match to d1fawa_
   complexed with hem

Details for d3eoka_

PDB Entry: 3eok, 2.1 Å

PDB Description: crystal structure determination of duck (anas platyrhynchos) hemoglobin at 2.1 angstrom resolution

PDB Compounds: (A:) Hemoglobin subunit alpha-A

SCOPe Domain Sequences for d3eoka_:

Sequence; same for both SEQRES and ATOM records:

>d3eoka_ a.1.1.2 (A:) automated matches {Duck (Anas platyrhynchos) [TaxId: 8839]}
vlsaadktnvkgvfskigghaeeygaetlermfiaypqtktyfphfdlshgsaqikahgk
kvaaalveavnhvddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpaaltpe
vhasldkfmcavgavltakyr

Timeline for d3eoka_:

• d3eoka_ first appeared in SCOPe 2.01
  
• d3eoka_ appears in SCOPe 2.07