Lineage for d3eoai_ (3eoa I:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999157Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 999158Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 999159Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 999222Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)
  7. 999223Species Human (Homo sapiens) [TaxId:9606] [53303] (25 PDB entries)
    Uniprot P20701 153-334
  8. 999261Domain d3eoai_: 3eoa I: [175114]
    automated match to d1lfaa_

Details for d3eoai_

PDB Entry: 3eoa (more details), 2.8 Å

PDB Description: Crystal structure the Fab fragment of Efalizumab in complex with LFA-1 I domain, Form I
PDB Compounds: (I:) Integrin alpha-L

SCOPe Domain Sequences for d3eoai_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eoai_ c.62.1.1 (I:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkki

SCOPe Domain Coordinates for d3eoai_:

Click to download the PDB-style file with coordinates for d3eoai_.
(The format of our PDB-style files is described here.)

Timeline for d3eoai_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3eoaj_