SCOPe 2.01: Domain d3enzd_: 3enz D:

Lineage for d3enzd_ (3enz D:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein automated matches [190142] (12 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [186993] (2 PDB entries)

8. Domain d3enzd_: 3enz D: [175111]
   automated match to d1nw4a_
   complexed with art, fmt, hpa, na, r1x

Details for d3enzd_

PDB Entry: 3enz, 2.03 Å

PDB Description: arsenolytic structure of plasmodium falciparum purine nucleoside phosphorylase with hypoxanthine, ribose and arsenate ion

PDB Compounds: (D:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d3enzd_:

Sequence; same for both SEQRES and ATOM records:

>d3enzd_ c.56.2.1 (D:) automated matches {Plasmodium falciparum [TaxId: 36329]}
nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli
hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavve
melatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacaklat
kyal

Timeline for d3enzd_:

• d3enzd_ is new in SCOPe 2.01-stable
  
• d3enzd_ appears in SCOPe 2.02
  
• d3enzd_ appears in the current release, SCOPe 2.08, called d3enzd1