Lineage for d3enzd1 (3enz D:3-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888641Protein automated matches [190142] (21 species)
    not a true protein
  7. 2888740Species Plasmodium falciparum [TaxId:36329] [186993] (3 PDB entries)
  8. 2888744Domain d3enzd1: 3enz D:3-245 [175111]
    Other proteins in same PDB: d3enza2, d3enzb2, d3enzc2, d3enzd2
    automated match to d1nw4a_
    complexed with art, fmt, hpa, na, r1x

Details for d3enzd1

PDB Entry: 3enz (more details), 2.03 Å

PDB Description: arsenolytic structure of plasmodium falciparum purine nucleoside phosphorylase with hypoxanthine, ribose and arsenate ion
PDB Compounds: (D:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d3enzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3enzd1 c.56.2.1 (D:3-245) automated matches {Plasmodium falciparum [TaxId: 36329]}
nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli
hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavve
melatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacaklat
kya

SCOPe Domain Coordinates for d3enzd1:

Click to download the PDB-style file with coordinates for d3enzd1.
(The format of our PDB-style files is described here.)

Timeline for d3enzd1: