Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein automated matches [190142] (21 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [186993] (3 PDB entries) |
Domain d3enzb1: 3enz B:3-245 [175109] Other proteins in same PDB: d3enza2, d3enzb2, d3enzc2, d3enzd2 automated match to d1nw4a_ complexed with art, fmt, hpa, na, r1x |
PDB Entry: 3enz (more details), 2.03 Å
SCOPe Domain Sequences for d3enzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3enzb1 c.56.2.1 (B:3-245) automated matches {Plasmodium falciparum [TaxId: 36329]} nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavve melatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacaklat kya
Timeline for d3enzb1: