Lineage for d3ennc1 (3enn C:1-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094549Species Brucella melitensis [TaxId:29459] [188645] (2 PDB entries)
  8. 2094552Domain d3ennc1: 3enn C:1-245 [175105]
    Other proteins in same PDB: d3enna2, d3ennb2, d3ennc2
    automated match to d1q7ba_

Details for d3ennc1

PDB Entry: 3enn (more details), 2.1 Å

PDB Description: 2.1A crystal structure of glucose/ribitol dehydrogenase from brucella melitensis (p43212)
PDB Compounds: (C:) glucose/ribitol dehydrogenase

SCOPe Domain Sequences for d3ennc1:

Sequence, based on SEQRES records: (download)

>d3ennc1 c.2.1.0 (C:1-245) automated matches {Brucella melitensis [TaxId: 29459]}
mfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifvfpan
lsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfnltr
elthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtvnci
apgfiesamtgklnekqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvng
gmami

Sequence, based on observed residues (ATOM records): (download)

>d3ennc1 c.2.1.0 (C:1-245) automated matches {Brucella melitensis [TaxId: 29459]}
mfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifvfpan
lsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfnltr
elthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtvnci
apgfiekdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvnggmami

SCOPe Domain Coordinates for d3ennc1:

Click to download the PDB-style file with coordinates for d3ennc1.
(The format of our PDB-style files is described here.)

Timeline for d3ennc1: