Lineage for d3enia_ (3eni A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068796Fold b.75: Bacteriochlorophyll A protein [51080] (1 superfamily)
    single sheet; 16 strands; meander
  4. 2068797Superfamily b.75.1: Bacteriochlorophyll A protein [51081] (1 family) (S)
    automatically mapped to Pfam PF02327
  5. 2068798Family b.75.1.1: Bacteriochlorophyll A protein [51082] (2 protein domains)
  6. 2068799Protein Bacteriochlorophyll A protein [51083] (2 species)
  7. 2068800Species Chlorobium tepidum [TaxId:1097] [51085] (2 PDB entries)
  8. 2068801Domain d3enia_: 3eni A: [175098]
    complexed with bcl

Details for d3enia_

PDB Entry: 3eni (more details), 2.2 Å

PDB Description: Crystal structure of the Fenna-Matthews-Olson Protein from Chlorobaculum Tepidum
PDB Compounds: (A:) Bacteriochlorophyll a protein

SCOPe Domain Sequences for d3enia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3enia_ b.75.1.1 (A:) Bacteriochlorophyll A protein {Chlorobium tepidum [TaxId: 1097]}
vttahsdyeivleggssswgkvkarakvnappaspllpadcdvklnvkpldpakgfvris
avfesivdstknkltieadianetkerrisvgegmvsvgdfshtfsfegsvvnlfyyrsd
avrrnvpnpiymqgrqfhdilmkvpldnndlidtwegtvkaigstgafndwirdfwfigp
aftalneggqrisrievnglntesgpkgpvgvsrwrfshggsgmvdsisrwaelfpsdkl
nrpaqveagfrsdsqgievkvdgefpgvsvdaggglrrilnhpliplvhhgmvgkfnnfn
vdaqlkvvlpkgykiryaapqyrsqnleeyrwsggayarwvehvckggvgqfeilyaq

SCOPe Domain Coordinates for d3enia_:

Click to download the PDB-style file with coordinates for d3enia_.
(The format of our PDB-style files is described here.)

Timeline for d3enia_: