SCOPe 2.08: Domain d3enab1: 3ena B:2-133

Lineage for d3enab1 (3ena B:2-133)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)

8. Domain d3enab1: 3ena B:2-133 [175097]
   Other proteins in same PDB: d3enaa2, d3enab2
   automated match to d2b8pa1
   complexed with dgi, mg; mutant

Details for d3enab1

PDB Entry: 3ena, 1.6 Å

PDB Description: crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with dgdp

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3enab1:

Sequence; same for both SEQRES and ATOM records:

>d3enab1 d.58.6.1 (B:2-133) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
lcdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandigenlihasdse
dsavdeisiwfp

Timeline for d3enab1:

• d3enab1 first appeared in SCOPe 2.01, called d3enab_
  
• d3enab1 appears in SCOPe 2.07