Lineage for d3enaa1 (3ena A:2-134)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557935Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2557936Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2558192Protein automated matches [190032] (18 species)
    not a true protein
  7. 2558193Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)
  8. 2558198Domain d3enaa1: 3ena A:2-134 [175096]
    Other proteins in same PDB: d3enaa2, d3enab2
    automated match to d2b8pa1
    complexed with dgi, mg; mutant

Details for d3enaa1

PDB Entry: 3ena (more details), 1.6 Å

PDB Description: crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with dgdp
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3enaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3enaa1 d.58.6.1 (A:2-134) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
lcdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandigenlihasdse
dsavdeisiwfpe

SCOPe Domain Coordinates for d3enaa1:

Click to download the PDB-style file with coordinates for d3enaa1.
(The format of our PDB-style files is described here.)

Timeline for d3enaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3enaa2