Class b: All beta proteins [48724] (177 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.0: automated matches [191552] (1 protein) not a true family |
Protein automated matches [190954] (11 species) not a true protein |
Species Hypocrea jecorina [TaxId:51453] [188627] (1 PDB entry) |
Domain d3emya_: 3emy A: [175093] automated match to d1e5oe_ |
PDB Entry: 3emy (more details), 1.85 Å
SCOPe Domain Sequences for d3emya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3emya_ b.50.1.0 (A:) automated matches {Hypocrea jecorina [TaxId: 51453]} etgsapnhpsdsadseyitsvsigtpaqvlpldfdtgssdlwvfssetpkssatghaiyt psksstskkvsgaswsisygdgssssgdvytdkvtiggfsvntqgvesatrvstefvqdt visglvglafdsgnqvrphpqktwfsnaasslaeplftadlrhgqngsynfgyidtsvak gpvaytpvdnsqgfweftasgysvgggklnrnsidgiadtgttllllddnvvdayyanvq saqydnqqegvvfdcdedlpsfsfgvgsstitipgdllnltpleegsstcfgglqsssgi ginifgdvalkaalvvfdlgnerlgwaqk
Timeline for d3emya_: